Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
USD 509.00
5 Days
USD 509.00
5 Days
TUBB2A mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TUBB2A mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 509.00
2 Weeks
USD 509.00
2 Weeks
USD 509.00
5 Days
TUBB2A mouse monoclonal antibody,clone 1H3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 509.00
5 Days
TUBB2A mouse monoclonal antibody,clone 1H3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Rabbit Polyclonal Anti-TUBB2A Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the N terminal of human TUBB2A. Synthetic peptide located within the following region: MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTRDEDDKLKKLV |
Rabbit Polyclonal Anti-TUBB2A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the middle region of human TUBB2A. Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC |
TUBB2A mouse monoclonal antibody,clone OTI3E6
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- BETA II TUBULIN
Pathways
- Pathogenic Escherichia coli infection