Rabbit polyclonal DNA Polymerase lambda antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DNA Polymerase ?. |
Rabbit polyclonal DNA Polymerase lambda antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DNA Polymerase ?. |
DNA Polymerase lambda (POLL) (C-term) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 546~575 amino acids from the C-terminal region of human DNA polymerase lambda. |
Goat Anti-POLL / BETA-N Antibody
Applications | IHC |
Reactivities | Human (Expected from sequence similarity: Mouse) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-LGLPYREPAERDW, from the C Terminus of the protein sequence according to NP_037406.1. |
Rabbit Polyclonal Anti-POLL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLL antibody is: synthetic peptide directed towards the middle region of Human POLL. Synthetic peptide located within the following region: DVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGV |
Rabbit Polyclonal Anti-POLL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLL antibody: synthetic peptide directed towards the middle region of human POLL. Synthetic peptide located within the following region: SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW |