Primary Antibodies

View as table Download

Rabbit Polyclonal GRF-1 (Tyr1105) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GRF-1 around the phosphorylation site of Tyrosine 1105
Modifications Phospho-specific

Rabbit Polyclonal Anti-GRLF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRLF1 antibody: synthetic peptide directed towards the N terminal of human GRLF1. Synthetic peptide located within the following region: RPSADEFHLDHTSVLSTSDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHI

Rabbit Polyclonal GRF-1 Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GRF-1