Anti-PYGB Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human phosphorylase, glycogen; brain |
Anti-PYGB Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human phosphorylase, glycogen; brain |
Anti-PYGB Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human phosphorylase, glycogen; brain |
Rabbit Polyclonal Anti-PYGB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PYGB antibody: synthetic peptide directed towards the N terminal of human PYGB. Synthetic peptide located within the following region: QQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDLE |
Rabbit Polyclonal Anti-PYGB Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | PYGB antibody was raised against synthetic 20 amino acid peptide from internal region of human PYGB. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Marmoset, Mouse, Rat, Sheep, Bat, Bovine, Hamster, Elephant, Panda, Rabbit, Pig, Turkey, Chicken, Lizard, Xenopus, Salmon, Pufferfish, Zebrafish, Stickleback, Drosophila (100%). |
Rabbit Polyclonal Anti-PYGB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PYGB antibody: synthetic peptide directed towards the N terminal of human PYGB. Synthetic peptide located within the following region: ADDWLRYGNPWEKARPEYMLPVHFYGRVEHTPDGVKWLDTQVVLAMPYDT |
GPBB (PYGB) mouse monoclonal antibody, clone 1G6
Applications | ELISA, WB |
Conjugation | Unconjugated |