Primary Antibodies

View as table Download

Mouse Monoclonal Rad51D Antibody (5B3/6)

Applications ICC/IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-RAD51D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD51D antibody is: synthetic peptide directed towards the C-terminal region of Human RAD51D. Synthetic peptide located within the following region: RLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEM

RAD51L3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated