Rabbit Polyclonal Anti-ACHE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACHE |
Rabbit Polyclonal Anti-ACHE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACHE |
Goat Polyclonal Antibody against ACHE
Applications | FC, IF, WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence QFDHYSKQDRCSDL, from the C Terminus of the protein sequence according to NP_000656.1. |
Rabbit Polyclonal Anti-ACHE Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACHE antibody: synthetic peptide directed towards the N terminal of human ACHE. Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV |
Acetylcholinesterase (ACHE) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 560-600 of Human AChE. |
USD 580.00
5 Days
Mouse monoclonal anti-ACHE antibody (C-term)
Applications | WB |
Reactivities | Human, Mouse, Rat (Predicted: Bovine, Rabbit) |
Conjugation | Unconjugated |
Rabbit polyclonal ACHE antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ACHE. |