Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-ARPC1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARPC1B antibody is: synthetic peptide directed towards the middle region of Human ARPC1B. Synthetic peptide located within the following region: KKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGS

ARPC1B (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human ARPC1B

Goat Polyclonal Antibody against ARPC1B

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence AYHSFLVEPISCH, from the N Terminus of the protein sequence according to NP_005711.

Rabbit Polyclonal Anti-ARPC1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARPC1B antibody is: synthetic peptide directed towards the C-terminal region of Human ARPC1B. Synthetic peptide located within the following region: RERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTT