Primary Antibodies

View as table Download

Rabbit Polyclonal IRF7 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IRF7 antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human IRF7. The immunogen is located within amino acids 420 - 470 of IRF7.

Anti-IRF7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 462-476 amino acids of Human interferon regulatory factor 8

Rabbit Polyclonal IRF7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IRF7 antibody was raised against a peptide corresponding to 14 amino acids near the center of human IRF7.

Rabbit Polyclonal Anti-IRF7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF7 antibody: synthetic peptide directed towards the N terminal of human IRF7. Synthetic peptide located within the following region: ISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIFKAWAVARGRWP

Rabbit Polyclonal Anti-IRF7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IRF7 antibody: synthetic peptide directed towards the middle region of human IRF7. Synthetic peptide located within the following region: EPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELEQPA

IRF7 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human IRF7

IRF7 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IRF7