Primary Antibodies

Jump to Filters
View as table Download
C4BPA Rabbit Polyclonal Antibody
TA346046

USD 539.00

5 Days

Rabbit Polyclonal Anti-C4BPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C4BPA antibody: synthetic peptide directed towards the middle region of human C4BPA. Synthetic peptide located within the following region: QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
C4BPA Mouse Monoclonal Antibody [Clone ID: 10-07]
AM01329PU-N

USD 770.00

5 Days

C4BPA mouse monoclonal antibody, clone 10-07, Purified

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated