Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal C-RAF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human C-RAF |
Rabbit polyclonal anti-POLB antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptidecorresponding to a region near the C-terminus of the POLβ protein. |
Rabbit Polyclonal Anti-POLB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLB antibody: synthetic peptide directed towards the middle region of human POLB. Synthetic peptide located within the following region: GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML |
POLB Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human POLB |
POLB Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human POLB |
Active filters
Target Symbol
- DNA POLYMERASE BETA
Pathways
- Base excision repair