Rabbit Polyclonal NTH1 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Bovine, Human, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the human NTH1 conjugated to KLH. |
Rabbit Polyclonal NTH1 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Bovine, Human, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the human NTH1 conjugated to KLH. |
Rabbit Polyclonal anti-NTHL1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NTHL1 |
Rabbit Polyclonal NTH1 Antibody
Applications | ICC/IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full-length recombinant protein. |
Rabbit Polyclonal anti-NTHL1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NTHL1 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
NTH1 (NTHL1) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 95-126 amino acids from the Central region of human NTHL1 |
Rabbit Polyclonal Anti-NTHL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NTHL1 antibody is: synthetic peptide directed towards the N-terminal region of Human NTHL1. Synthetic peptide located within the following region: DWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS |
NTHL1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human NTHL1 |