Primary Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) SEMA3D mouse monoclonal antibody,clone OTI2H4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SEMA3D Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 627-642 amino acids of human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D

SEMA3D mouse monoclonal antibody,clone OTI2H4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-SEMA3D Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 627-642 amino acids of human sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3D

Rabbit Polyclonal SEMA3D Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Semaphorin 3D (SEMA3D) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 610-640 amino acids from the C-terminal region of Human SEMA3D

Rabbit polyclonal Anti-SEMA3D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMA3D antibody: synthetic peptide directed towards the middle region of human SEMA3D. Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS