Primary Antibodies

View as table Download

Rabbit polyclonal CACNA2D2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2.

Rabbit Polyclonal Anti-CACNA2D2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNA2D2 antibody is: synthetic peptide directed towards the C-terminal region of Human CACNA2D2. Synthetic peptide located within the following region: NCSRLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHSDGPEQCELV