Primary Antibodies

Jump to Filters
View as table Download
UXS 1 (UXS1) (C-term) Rabbit Polyclonal Antibody
AP54498PU-N

USD 580.00

2 Weeks

UXS 1 (UXS1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 336-366 amino acids from the C-terminal region of human UXS1
UXS 1 (UXS1) Rabbit Polyclonal Antibody
TA338694

USD 539.00

5 Days

Rabbit Polyclonal Anti-UXS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UXS1 antibody: synthetic peptide directed towards the middle region of human UXS1. Synthetic peptide located within the following region: LMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRH
UXS 1 (UXS1) Rabbit Polyclonal Antibody
TA356841

USD 539.00

5 Days

UXS1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of human UXS1
UXS 1 (UXS1) Rabbit Polyclonal Antibody
TA361729

USD 539.00

5 Days

UXS1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human UXS1