Primary Antibodies

View as table Download

Carrier-free (BSA/glycerol-free) CHST6 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications WB
Reactivities Human, Dog, Monkey, Mouse
Conjugation Unconjugated

B3GNT2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-CHST2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHST2 antibody: synthetic peptide directed towards the middle region of human CHST2. Synthetic peptide located within the following region: NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL

USD 380.00

Backordered

Rabbit Polyclonal Anti-FUT8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human FUT8

B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

B4GALT3 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Rabbit polyclonal antibody to ST3GAL1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 195 of SIAT4A (Uniprot ID#Q11201)

B4GALT4 mouse monoclonal antibody, clone OTI8B6 (formerly 8B6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

B3GNT2 mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".