SDHB mouse monoclonal antibody,clone OTI1E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SDHB mouse monoclonal antibody,clone OTI1E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SDHB mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SDHB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SDHB |
SDHB mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Carrier-free (BSA/glycerol-free) SDHB mouse monoclonal antibody,clone OTI1E4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SDHB mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SDHB mouse monoclonal antibody,clone OTI1E4, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SDHB mouse monoclonal antibody,clone OTI1E4, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SDHB mouse monoclonal antibody, clone OTI2A3 (formerly 2A3), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
SDHB mouse monoclonal antibody, clone OTI2A3 (formerly 2A3), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
SDHB mouse monoclonal antibody,clone UMAB268
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
SDHB mouse monoclonal antibody,clone OTI2A1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal SDHB Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an N-terminal region of the human SDHB protein (within residues 1-150). [Swiss-Prot P21912] |
Rabbit Polyclonal Anti-SDHB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB. Synthetic peptide located within the following region: YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAE |
Rabbit Polyclonal antibody to SDHB (succinate dehydrogenase complex, subunit B, iron sulfur (Ip))
Applications | IF, WB |
Reactivities | Human (Predicted: Rat, Pig, Bovine, Rhesus Monkey) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 221 and 280 of SDHB (Uniprot ID#P21912) |