Primary Antibodies

Jump to Filters
View as table Download
TM9SF4 Rabbit Polyclonal Antibody
TA317430

USD 515.00

5 Days

TM9SF4 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Human, Gibbon, Orang-Utan (Predicted: Monkey, Bat, Bovine, Dog, Horse, Pig, Rabbit)
Conjugation Unconjugated
Immunogen TM9SF4 antibody was raised against synthetic 15 amino acid peptide from internal region of human TM9SF4. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Elephant, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Panda (87%); Opossum (80%).
TM9SF4 Rabbit Polyclonal Antibody
TA341953

USD 539.00

5 Days

Rabbit Polyclonal Anti-TM9SF4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TM9SF4 antibody: synthetic peptide directed towards the N terminal of human TM9SF4. Synthetic peptide located within the following region: HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR