Primary Antibodies

Jump to Filters
View as table Download
ATP5PB Rabbit Polyclonal Antibody
TA346561

USD 539.00

5 Days

Rabbit Polyclonal Anti-ATP5F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP5F1 antibody: synthetic peptide directed towards the middle region of human ATP5F1. Synthetic peptide located within the following region: VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST
ATP5PB Goat Polyclonal Antibody
TA329080

USD 520.00

5 Days

ATP5F1 (aa142-153) Goat Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Internal region (SIQHIQNAIDTE)