Primary Antibodies

View as table Download

Anti-ACMSD Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal antibody to ACMSD (aminocarboxymuconate semialdehyde decarboxylase)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 105 and 336 of ACMSD (Uniprot ID#Q8TDX5)

Anti-ACMSD Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-ACMSD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACMSD antibody: synthetic peptide directed towards the middle region of human ACMSD. Synthetic peptide located within the following region: NPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELE