Primary Antibodies

Jump to Filters
View as table Download
Somatostatin Receptor 1 (SSTR1) Rabbit Polyclonal Antibody
TA323285

USD 380.00

2 Weeks

Anti-SSTR1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of human somatostatin receptor 1
Somatostatin Receptor 1 (SSTR1) Rabbit Polyclonal Antibody
TA323284

USD 380.00

In Stock

Anti-SSTR1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of human somatostatin receptor 1
Somatostatin Receptor 1 (SSTR1) Rabbit Polyclonal Antibody
TA326147

USD 380.00

In Stock

Rabbit polyclonal SSTR1 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SSTR1.
Somatostatin Receptor 1 (SSTR1) Rabbit Polyclonal Antibody
TA342651

USD 539.00

5 Days

Rabbit Polyclonal Anti-SSTR1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SSTR1 antibody: synthetic peptide directed towards the C terminal of human SSTR1. Synthetic peptide located within the following region: RMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
Somatostatin Receptor 1 (SSTR1) Rabbit Polyclonal Antibody
TA342650

USD 539.00

5 Days

Rabbit Polyclonal Anti-SSTR1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sstr1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Sstr1. Synthetic peptide located within the following region: QRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTC