Primary Antibodies

Jump to Filters
View as table Download
MCP4 (CCL13) Rabbit Polyclonal Antibody
TA322619

USD 380.00

4 Weeks

Anti-CCL13 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 86-98 amino acids of Human C-C motif chemokine 13
MCP4 (CCL13) Rabbit Polyclonal Antibody
TA330376

USD 539.00

5 Days

Rabbit Polyclonal Anti-CCL13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL13 antibody: synthetic peptide directed towards the middle region of human CCL13. Synthetic peptide located within the following region: KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT