Primary Antibodies

View as table Download

Goat Anti-UNC5C Antibody

Applications IF
Reactivities Human, Mouse (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence NCTVSEEPTGID, from the internal region of the protein sequence according to NP_003719.2.

Rabbit Polyclonal Anti-UNC5C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC5C antibody is: synthetic peptide directed towards the middle region of Human UNC5C. Synthetic peptide located within the following region: EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFE

Rabbit Polyclonal Anti-UNC5C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC5C antibody: synthetic peptide directed towards the middle region of human UNC5C. Synthetic peptide located within the following region: VVVALFVYRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTS

Rabbit Polyclonal Anti-UNC5C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UNC5C antibody: synthetic peptide directed towards the C terminal of human UNC5C. Synthetic peptide located within the following region: WRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEE