Primary Antibodies

View as table Download

Rabbit polyclonal anti-EPHA5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPHA5.

Rabbit Polyclonal Anti-EPHA5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHA5 antibody: synthetic peptide directed towards the middle region of human EPHA5. Synthetic peptide located within the following region: SDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIP

Rabbit Polyclonal Anti-EPHA5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EPHA5 Antibody: A synthesized peptide derived from human EPHA5