Primary Antibodies

Jump to Filters
View as table Download
CYC1 Rabbit Polyclonal Antibody
TA340034

USD 539.00

5 Days

Rabbit Polyclonal Anti-CYC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYC1 antibody: synthetic peptide directed towards the middle region of human CYC1. Synthetic peptide located within the following region: RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP
CYC1 Rabbit Polyclonal Antibody
TA313717

USD 380.00

In Stock

Rabbit polyclonal anti-CYC1 antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CYC1.