USD 570.00
2 Weeks
Mouse Monoclonal Anti-GABA(A) Receptor beta3 Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
USD 570.00
2 Weeks
Mouse Monoclonal Anti-GABA(A) Receptor beta3 Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
GABA A Receptor beta 3 (GABRB3) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Bovine, Canine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EKTAKAKNDRSK, from the internal region of the protein sequence according to NP_000805.1; NP_068712.1. |
Rabbit Polyclonal anti-GABRB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GABRB3 antibody is: synthetic peptide directed towards the middle region of Human GABRB3. Synthetic peptide located within the following region: DIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSF |
Rabbit Polyclonal Anti-GABRB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GABRB3 antibody is: synthetic peptide directed towards the middle region of Human GABRB3. Synthetic peptide located within the following region: FYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK |
Rabbit Polyclonal Anti-GABRB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GABRB3 antibody: synthetic peptide directed towards the middle region of human GABRB3. Synthetic peptide located within the following region: ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA |
GABA A Receptor beta 3 (GABRB3) goat polyclonal antibody
Reactivities | Human |
Conjugation | Unconjugated |