Primary Antibodies

Jump to Filters
View as table Download
GABA A Receptor beta 3 (GABRB3) Goat Polyclonal Antibody
AP10064PU-N

USD 520.00

5 Days

GABA A Receptor beta 3 (GABRB3) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bovine, Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-EKTAKAKNDRSK, from the internal region of the protein sequence according to NP_000805.1; NP_068712.1.
GABA A Receptor beta 3 (GABRB3) Rabbit Polyclonal Antibody
TA329171

USD 539.00

5 Days

Rabbit Polyclonal anti-GABRB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GABRB3 antibody is: synthetic peptide directed towards the middle region of Human GABRB3. Synthetic peptide located within the following region: DIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSF
GABA A Receptor beta 3 (GABRB3) Rabbit Polyclonal Antibody
TA329172

USD 485.00

5 Days

Rabbit Polyclonal Anti-GABRB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GABRB3 antibody is: synthetic peptide directed towards the middle region of Human GABRB3. Synthetic peptide located within the following region: FYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK
GABA A Receptor beta 3 (GABRB3) Rabbit Polyclonal Antibody
TA338701

USD 539.00

5 Days

Rabbit Polyclonal Anti-GABRB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRB3 antibody: synthetic peptide directed towards the middle region of human GABRB3. Synthetic peptide located within the following region: ESYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGA
GABA A Receptor beta 3 (GABRB3) Goat Polyclonal Antibody
GT41011-100

USD 645.00

2 Weeks

GABA A Receptor beta 3 (GABRB3) goat polyclonal antibody

Reactivities Human
Conjugation Unconjugated