Primary Antibodies

Jump to Filters
View as table Download
CLDN16 (N-term) Rabbit Polyclonal Antibody
AP50943PU-N

USD 580.00

2 Weeks

CLDN16 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 13-41 amino acids from the N-terminal region of human CLDN16
CLDN16 Rabbit Polyclonal Antibody
TA334204

USD 539.00

5 Days

Rabbit Polyclonal Anti-CLDN16 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN16 antibody: synthetic peptide directed towards the C terminal of human CLDN16. Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA
CLDN16 Rabbit Polyclonal Antibody
TA334205

USD 485.00

5 Days

Rabbit Polyclonal Anti-CLDN16 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN16 antibody: synthetic peptide directed towards the C terminal of human CLDN16. Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA