Primary Antibodies

Jump to Filters
View as table Download
Frizzled 7 (FZD7) Rabbit Polyclonal Antibody
TA344065

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-FZD7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
Frizzled 7 (FZD7) Goat Polyclonal Antibody
TA303332

USD 520.00

In Stock

Goat Polyclonal Antibody against FZD7

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse)
Conjugation Unconjugated
Immunogen Peptide with sequence C-RFYHRLSHSSKGET, from the C Terminus of the protein sequence according to NP_003498.1.