Primary Antibodies

Jump to Filters
View as table Download
IL3RA Mouse Monoclonal Antibody [Clone ID: OTI10D1]
TA813795S

USD 200.00

In Stock

IL3RA mouse monoclonal antibody, clone OTI10D1

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

IL3RA Mouse Monoclonal Antibody [Clone ID: OTI4A10]
TA813664S

USD 200.00

2 Days

IL3RA mouse monoclonal antibody, clone OTI4A10

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

IL3RA Mouse Monoclonal Antibody [Clone ID: OTI10D4]
TA813796S

USD 200.00

2 Days

IL3RA mouse monoclonal antibody, clone OTI10D4

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

IL3RA Rabbit Polyclonal Antibody
TA325019

USD 580.00

5 Days

Rabbit polyclonal IL3RA Antibody (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IL3RA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-348 amino acids from the C-terminal region of human IL3RA.
IL3RA Rabbit Polyclonal Antibody
TA343332

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL3RA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL3RA antibody is: synthetic peptide directed towards the middle region of Human IL3RA. Synthetic peptide located within the following region: APADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS
IL3RA Goat Polyclonal Antibody
TA348953

USD 520.00

5 Days

Goat Polyclonal Anti-IL3RA / CD123 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IL3RA / CD123 Antibody: Peptide with sequence RQQYECLHYKTD, from the internal region of the protein sequence according to NP_002174.1; NP_001254642.1.