Primary Antibodies

View as table Download

POLR3H mouse monoclonal antibody,clone OTI4D8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) POLR3H mouse monoclonal antibody,clone OTI4D8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POLR3H mouse monoclonal antibody,clone OTI5A12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) POLR3H mouse monoclonal antibody,clone OTI5A12

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

POLR3H mouse monoclonal antibody,clone OTI5A12, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Rabbit polyclonal anti-POLR3H (RPC8) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC8.

Rabbit Polyclonal Anti-POLR3H Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3H antibody: synthetic peptide directed towards the middle region of human POLR3H. Synthetic peptide located within the following region: AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL