Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
USD 509.00
2 Weeks
USD 509.00
2 Weeks
Rabbit Polyclonal Anti-PA2G4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PA2G4 antibody: synthetic peptide directed towards the C terminal of human PA2G4. Synthetic peptide located within the following region: LLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQ |
Rabbit polyclonal EBP1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human (Predicted: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | This EBP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 228-255 amino acids from the Central region of human EBP1. |
Rabbit anti-PA2G4 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PA2G4 |
Rabbit Polyclonal Anti-PA2G4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PA2G4 antibody: synthetic peptide directed towards the middle region of human PA2G4. Synthetic peptide located within the following region: NCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVD |
PA2G4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human PA2G4 |
PA2G4 (EBP1) mouse monoclonal antibody, clone OTI1D3 (formerly 1D3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- EBP1
Families
- Stem cell - Pluripotency