c-Myb (MYB) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from human MYB (aa1-50). aa1-50 |
c-Myb (MYB) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from human MYB (aa1-50). aa1-50 |
c-Myb (MYB) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 491-540 of Human c-Myb. |
Goat Polyclonal Antibody against MYB / c-myb
Applications | IHC, WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QRHYNDEDPEKEKR, from the internal region of the protein sequence according to NP_005366.2. |
Rabbit Polyclonal Anti-MYB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYB antibody: synthetic peptide directed towards the N terminal of human MYB. Synthetic peptide located within the following region: YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD |
Rabbit Polyclonal Myb Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Myb |
Rabbit polyclonal Myb (Ab-532) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Myb around the phosphorylation site of serine 532 (V-E-SP-P-T). |
Rabbit Polyclonal Anti-MYB Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MYB |
c-Myb (MYB) (557-569) goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide corresponding to internal region of Human c-Myb |
Rabbit Polyclonal Anti-MYB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MYB antibody is: synthetic peptide directed towards the C-terminal region of Human MYB. Synthetic peptide located within the following region: AFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSART |
Rabbit Polyclonal anti-MYB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MYB antibody is: synthetic peptide directed towards the C-terminal region of Human MYB. Synthetic peptide located within the following region: VPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM |
Rabbit polyclonal Myb (Phospho-Ser532) antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Myb around the phosphorylation site of serine 532 (V-E-SP-P-T). |
Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Myb (Ser532) Antibody (Phospho-specific)
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Myb around the phosphorylation site of Serine 532 |
Modifications | Phospho-specific |
Mouse anti c-myb / v-myb Monoclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |