Primary Antibodies

Jump to Filters
View as table Download
PSMD11 Rabbit Polyclonal Antibody
TA314396

USD 380.00

4 Weeks

Rabbit polyclonal anti-PSMD11 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PSMD11.
PSME3 Rabbit Polyclonal Antibody
TA326811

USD 365.00

3 Weeks

PSME3 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSME3
PSMD11 Rabbit Polyclonal Antibody
TA330261

USD 539.00

5 Days

Rabbit Polyclonal Anti-PSMD11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMD11 antibody: synthetic peptide directed towards the N terminal of human PSMD11. Synthetic peptide located within the following region: MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSI
PSMD11 Rabbit Polyclonal Antibody
TA330262

USD 485.00

5 Days

Rabbit Polyclonal Anti-PSMD11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMD11 antibody: synthetic peptide directed towards the N terminal of human PSMD11. Synthetic peptide located within the following region: MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSI
PSMA3 Rabbit Polyclonal Antibody
TA344628

USD 539.00

5 Days

Rabbit Polyclonal Anti-PSMA3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3. Synthetic peptide located within the following region: TCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREE
PSMA3 Rabbit Polyclonal Antibody
TA362850

USD 539.00

5 Days

PSMA3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PSMA3
Proteasome subunit alpha type 6 (PSMA6) Mouse Monoclonal Antibody [Clone ID: OTI1A4]
TA800106S

USD 200.00

2 Days

PSMA6 (Proteasome 20S alpha 6) mouse monoclonal antibody, clone OTI1A4 (formerly 1A4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PSMA3 Rabbit Polyclonal Antibody
TA327024

USD 365.00

3 Weeks

PSMA3 Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMA3