Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-LEFTY2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit polyclonal antibody to Lefty -A (left-right determination factor 2)

Applications IHC, WB
Reactivities Human (Predicted: Rat)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 25 and 366 of LEFTY2 (Uniprot ID#O00292)

Rabbit Polyclonal Anti-LEFTY2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEFTY2 antibody: synthetic peptide directed towards the N terminal of human LEFTY2. Synthetic peptide located within the following region: MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK

Rabbit Polyclonal Anti-LEFTY2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LEFTY2 antibody is: synthetic peptide directed towards the N-terminal region of Human LEFTY2. Synthetic peptide located within the following region: AGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLL