Primary Antibodies

Jump to Filters
View as table Download
GDF 5 (GDF5) (C-term) Rabbit Polyclonal Antibody
AP51811PU-N

USD 580.00

2 Weeks

GDF 5 (GDF5) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen conjugated synthetic peptide between 350-379 amino acids from the C-terminal region of human BMP14 / GDF5
GDF 5 (GDF5) Rabbit Polyclonal Antibody
TA343293

USD 539.00

5 Days

Rabbit Polyclonal Anti-GDF5 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GDF5 antibody is: synthetic peptide directed towards the C-terminal region of GDF5. Synthetic peptide located within the following region: YLFSQRRKRRAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAP
GDF 5 (GDF5) Rabbit Polyclonal Antibody
TA361886

USD 539.00

5 Days

GDF5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GDF5