Rabbit polyclonal antibody to Glutathione peroxidase 7 (glutathione peroxidase 7)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Chimpanzee) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 187 of GPX7 (Uniprot ID#Q96SL4) |
Rabbit Polyclonal Anti-GPX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI |
Goat Polyclonal Antibody against GPX7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CNQFGQQEPDSNK, from the internal region of the protein sequence according to NP_056511.2. |
Germany
Japan
United Kingdom
China
