Primary Antibodies

View as table Download

Rabbit polyclonal antibody to SHKBP1 (SH3KBP1 binding protein 1)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Xenopus, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 162 and 477 of SHKBP1 (Uniprot ID#Q8TBC3)

Rabbit Polyclonal Anti-SHKBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SHKBP1 antibody is: synthetic peptide directed towards the N-terminal region of Human SHKBP1. Synthetic peptide located within the following region: TVFAPILNFLRTKELDPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRS