Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Goat Anti-NOX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKATDIVTGLKQK, from the internal region of the protein sequence according to NP_008983.2; NP_39249.1. |
Rabbit Polyclonal Anti-NOX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOX1 antibody: synthetic peptide directed towards the C terminal of human NOX1. Synthetic peptide located within the following region: STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF |
Rabbit polyclonal anti-NOX1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX1. |
Rabbit anti-CYBB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CYBB |
Rabbit Polyclonal Anti-CYBB Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYBB antibody: synthetic peptide directed towards the C terminal of human CYBB. Synthetic peptide located within the following region: IASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF |
Rabbit Polyclonal Anti-CYBB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CYBB antibody is: synthetic peptide directed towards the C-terminal region of Human CYBB. Synthetic peptide located within the following region: GRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGV |
NOX1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C region of human NOX1 |
Active filters
Families
- Ion Channels: Other
Pathways
- Leukocyte transendothelial migration