Primary Antibodies

Jump to Filters
View as table Download
CHRNA5 Mouse Monoclonal Antibody [Clone ID: OTI8H10]
TA810073

USD 447.00

In Stock

CHRNA5 mouse monoclonal antibody,clone OTI8H10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CHRNA5 Mouse Monoclonal Antibody [Clone ID: OTI8H10]
CF810073

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) CHRNA5 mouse monoclonal antibody,clone OTI8H10

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CHRNA5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H10]
TA810073BM

USD 509.00

2 Weeks

CHRNA5 mouse monoclonal antibody,clone OTI8H10, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
CHRNA5 Goat Polyclonal Antibody
TA311142

USD 520.00

In Stock

Goat Anti-CHRNA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HVDRYFTQKEET, from the internal region of the protein sequence according to NP_000736.2.
CHRNA5 Rabbit Polyclonal Antibody
TA327158

USD 365.00

3 Weeks

CHRNA5 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human CHRNA5
CHRNA5 Rabbit Polyclonal Antibody
TA338362

USD 539.00

5 Days

Rabbit Polyclonal Anti-CHRNA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA5 antibody: synthetic peptide directed towards the middle region of human CHRNA5. Synthetic peptide located within the following region: PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD
CHRNA5 Rabbit Polyclonal Antibody
TA338363

USD 485.00

5 Days

Rabbit Polyclonal Anti-CHRNA5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA5 antibody: synthetic peptide directed towards the middle region of human CHRNA5. Synthetic peptide located within the following region: DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS