Germany
Japan
United Kingdom
China
USD 539.00
5 Days
Primary Antibodies
View as table Download
USD 500.00
2 Weeks
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (Internal) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Bovine, Canine, Chicken, Equine, Monkey, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from an internal region of human CHRNA7 (NP_000737.1) |
USD 485.00
2 Weeks
Rabbit Polyclonal Anti-CHRNA7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNA7 antibody: synthetic peptide directed towards the middle region of human CHRNA7. Synthetic peptide located within the following region: VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF |
USD 485.00
5 Days
Rabbit Polyclonal Anti-CHRNA7 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHRNA7 antibody: synthetic peptide directed towards the N terminal of human CHRNA7. Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV |
USD 520.00
2 Weeks
Goat Polyclonal Anti-CHRNA7 Antibody
| Reactivities | Rat (Expected from sequence similarity: Human, Mouse, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CHRNA7 Antibody: Peptide with sequence KRPGEDKVRPACQHKQ, from the internal region of the protein sequence according to NP_000737.1. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Families
- Ion Channels: Cys-loop Receptors
Pathways
- Calcium signaling pathway