Primary Antibodies

Jump to Filters
View as table Download
PCK1 Rabbit Polyclonal Antibody
TA331174

USD 539.00

5 Days

Rabbit Polyclonal Anti-PCK1 Antibody

Applications WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS
PCK1 Goat Polyclonal Antibody
TA305772

USD 520.00

5 Days

Goat Anti-PCK1 / PEPCKC (internal) Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-HVNWFRKDKEGK, from the internal region of the protein sequence according to NP_002582.3.