Primary Antibodies

Jump to Filters
View as table Download
ADCY10 Rabbit Polyclonal Antibody
TA342378

USD 539.00

5 Days

Rabbit Polyclonal Anti-SAC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SAC antibody: synthetic peptide directed towards the N terminal of human SAC. Synthetic peptide located within the following region: VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL
ADCY10 Rabbit Polyclonal Antibody
TA356652

USD 539.00

5 Days

ADCY10 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ADCY10