Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PPOX Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PPOX

Rabbit polyclonal Anti-PPOX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPOX antibody: synthetic peptide directed towards the N terminal of human PPOX. Synthetic peptide located within the following region: SSERLGGWIRSVRGPNGAIFELGPRGIRPAGALGARTLLLVSELGLDSEV

Rabbit polyclonal Anti-PPOX Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPOX antibody is: synthetic peptide directed towards the C-terminal region of Human PPOX. Synthetic peptide located within the following region: GGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGKEPDETVHSFAQ