Primary Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 9 of 9 results

(reset)

VEGFC Mouse Monoclonal Antibody [Clone ID: OTI4A1]

TA801089

USD 447.00

4 Weeks

VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

VEGFC Mouse Monoclonal Antibody [Clone ID: OTI4A1]

CF801089

USD 600.00

3 Weeks

Carrier-free (BSA/glycerol-free) VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

VEGFC Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A1]

TA801089AM

USD 509.00

5 Days

VEGFC mouse monoclonal antibody,clone 4A1, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

VEGFC Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A1]

TA801089BM

USD 509.00

5 Days

VEGFC mouse monoclonal antibody,clone 4A1, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

VEGFC Mouse Monoclonal Antibody [Clone ID: OTI4A1]

TA801089S

USD 200.00

4 Weeks

VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

VEGFC Rabbit Polyclonal Antibody

TA321716

USD 380.00

2 Weeks

Anti-VEGFC Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 256-270 amino acids of human vascular endothelial growth factor C

1 / 3

2 / 3

3 / 3

Previous Next

VEGFC Mouse Monoclonal Antibody [Clone ID: 9E7]

DM3527

USD 440.00

2 Weeks

VEGFC mouse monoclonal antibody, clone 9E7, Purified

Applications	IF, IHC, WB
Reactivities	Human, Rat
Conjugation	Unconjugated

1 / 3

2 / 3

3 / 3

Previous Next

VEGFC (N-term) Rabbit Polyclonal Antibody

AP54506PU-N

USD 580.00

2 Weeks

VEGFC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	KLH conjugated synthetic peptide between 27-57 amino acids from the N-terminal region of human VEGF3

1 / 3

2 / 3

3 / 3

Previous Next

VEGFC Rabbit Polyclonal Antibody

TA343278

USD 539.00

5 Days

Rabbit Polyclonal Anti-VEGFC Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-VEGFC antibody is: synthetic peptide directed towards the C-terminal region of Human VEGFC. Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD

1 - 9 of 9 results