Rabbit Polyclonal Anti-HMGCL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HMGCL |
Rabbit Polyclonal Anti-HMGCL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HMGCL |
Rabbit Polyclonal antibody to HMGCL (3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 325 of HMGCL (Uniprot ID#P35914) |
Rabbit Polyclonal Anti-Hmgcl Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Hmgcl Antibody is: synthetic peptide directed towards the C-terminal region of Rat Hmgcl. Synthetic peptide located within the following region: MGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLTGLGIHTGVNLQKLL |
Rabbit Polyclonal Anti-HMGCL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HMGCL antibody: synthetic peptide directed towards the N terminal of human HMGCL. Synthetic peptide located within the following region: WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA |
Rabbit Polyclonal Anti-HMGCL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HMGCL antibody: synthetic peptide directed towards the C terminal of human HMGCL. Synthetic peptide located within the following region: LATEDLVYMLEGLGIHTGVNLQKLLEAGNFICQALNRKTSSKVAQATCKL |