Primary Antibodies

Jump to Filters
View as table Download
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA321403

USD 380.00

In Stock

Anti-CKM Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 14-26 amino acids of Human creatine kinase, muscle
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA313625

USD 380.00

In Stock

Rabbit polyclonal anti-CKM / M-CK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human M-CK.
Creatine kinase M type (CKM) Goat Polyclonal Antibody
TA348989

USD 520.00

5 Days

Goat Polyclonal Anti-creatine kinase M-type (aa258-270) Antibody

Applications WB
Reactivities Human, Mouse, Pig (Expected from sequence similarity: Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-creatine kinase M-type (aa258-270) Antibody: Peptide with sequence C-QKIEEIFKKAGHP, from the internal region of the protein sequence according to NP_001815.2.
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA346079

USD 539.00

5 Days

Rabbit Polyclonal Anti-CKM Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the N terminal of human CKM. Synthetic peptide located within the following region: VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL
Creatine kinase M type (CKM) Rabbit Polyclonal Antibody
TA346080

USD 539.00

5 Days

Rabbit Polyclonal Anti-CKM Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the middle region of human CKM. Synthetic peptide located within the following region: GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI