Primary Antibodies

Jump to Filters
View as table Download
INPP5B Rabbit Polyclonal Antibody
TA368548

USD 380.00

4 Weeks

INPP5B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human INPP5B
INPP5B Rabbit Polyclonal Antibody
TA372779

USD 380.00

4 Weeks

INPP5B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human INPP5B
INPP5B (C-term) Rabbit Polyclonal Antibody
AP52214PU-N

USD 580.00

2 Weeks

INPP5B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 957-987 amino acids from the C-terminal region of Human INPP5B / 5PTase 2.
INPP5B Rabbit Polyclonal Antibody
TA308024

USD 625.00

2 Weeks

Rabbit Polyclonal antibody to INPP5B (inositol polyphosphate-5-phosphatase, 75kDa)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 699 and 949 of INPP5B (Uniprot ID#P32019)
INPP5B Rabbit Polyclonal Antibody
TA335095

USD 539.00

5 Days

Rabbit Polyclonal Anti-INPP5B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INPP5B antibody: synthetic peptide directed towards the middle region of human INPP5B. Synthetic peptide located within the following region: IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN