Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
STEAP3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 440-470 amino acids from the C-terminal region of human STEAP3 |
STEAP3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human STEAP3 |
Rabbit Polyclonal Anti-STEAP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-STEAP3 Antibody: synthetic peptide directed towards the C terminal of human STEAP3. Synthetic peptide located within the following region: VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL |
Rabbit Polyclonal Anti-STEAP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-STEAP3 Antibody: synthetic peptide directed towards the N terminal of human STEAP3. Synthetic peptide located within the following region: LVGSGFKVVVGSRNPKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHY |
Rabbit Polyclonal Anti-STEA3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STEA3 Antibody: A synthesized peptide derived from human STEA3 |
Active filters
Target Symbol
- STEAP3
Conjugates
- Unconjugated
Pathways
- p53 signaling pathway