Primary Antibodies

Jump to Filters
View as table Download
CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: OTI2C2]
TA506937

USD 447.00

In Stock

FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications WB
Reactivities Human
Conjugation Unconjugated
CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: OTI1F2]
TA506903

USD 447.00

In Stock

FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications WB
Reactivities Human
Conjugation Unconjugated
CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: OTI1F2]
CF506903

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications WB
Reactivities Human
Conjugation Unconjugated
CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: OTI2C2]
CF506937

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)

Applications WB
Reactivities Human
Conjugation Unconjugated
CD95 (FAS) Rabbit Polyclonal Antibody
TA323754

USD 380.00

4 Weeks

Anti-FAS Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 156-335 amino acids of human Fas (TNF receptor superfamily, member 6)
CD95 (FAS) Rabbit Polyclonal Antibody
TA313381

USD 380.00

In Stock

Rabbit polyclonal anti-FAS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Fas.
CD95 (FAS) Rabbit Polyclonal Antibody
TA590390

USD 482.00

In Stock

Rabbit Polyclonal Fas Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.
CD95 (FAS) Rabbit Polyclonal Antibody
AP06448PU-N

USD 465.00

3 Weeks

CD95 (FAS) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 280-330 of Human CD95.
CD95 (FAS) (Center) Rabbit Polyclonal Antibody
AP18016PU-N

USD 580.00

2 Weeks

CD95 (FAS) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen conjugated synthetic peptide selected from the Center region of human FAS
CD95 (FAS) (323-327) Rabbit Polyclonal Antibody
AP26059PU-N

USD 405.00

2 Weeks

CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.323~327 derived from human Fas .
CD95 (FAS) (323-327) Rabbit Polyclonal Antibody
AP26059PU-S

USD 315.00

2 Weeks

CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.323~327 derived from human Fas .
CD95 (FAS) Goat Polyclonal Antibody
TA305714

USD 520.00

5 Days

Goat Anti-FAS / CD95 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1.
CD95 (FAS) Rabbit Polyclonal Antibody
TA326787

USD 365.00

3 Weeks

FAS Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human FAS
CD95 (FAS) Rabbit Polyclonal Antibody
TA337864

USD 539.00

5 Days

Rabbit Polyclonal Anti-FAIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD
CD95 (FAS) Mouse Monoclonal Antibody [Clone ID: 4C3-G7-B7-H5]
TA346945

USD 380.00

4 Weeks

Mouse Monoclonal FAS (C-terminus) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated