Primary Antibodies

View as table Download

Anti-CLDN7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 199-212 amino acids of Human claudin 7

Claudin 7 (CLDN7) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 172-201 amino acids from the C-terminal region of human CLDN7

Rabbit polyclonal Claudin 7 (Ab-210) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen he antiserum was produced against synthesized non-phosphopeptide derived from human Claudin 7 around the phosphorylation site of tyrosine 210 (S-K-E-YP-V).

Rabbit polyclonal anti-Claudin 7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Claudin 7.

Claudin 7 (CLDN7) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-CLDN7 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 199-212 amino acids of Human claudin 7

CLDN7 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CLDN7

Rabbit Polyclonal anti-CLDN7 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN7 antibody: synthetic peptide directed towards the C terminal of human CLDN7. Synthetic peptide located within the following region: GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV

Rabbit Polyclonal Anti-CLDN7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLDN7 Antibody: synthetic peptide directed towards the middle region of human CLDN7. Synthetic peptide located within the following region: GPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRVPRSYPKSNSSKEYV

Rabbit Polyclonal Anti-Claudin 7 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Claudin 7 Antibody: A synthesized peptide derived from human Claudin 7

Rabbit anti Claudin 7 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen peptide from C-terminus of human claudin 7 protein. This sequence is identical to human, rat, mouse and bovine.

Rabbit polyclonal Claudin 7 (Tyr210) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Claudin 7 around the phosphorylation site of tyrosine 210 (S-K-E-YP-V).
Modifications Phospho-specific