Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HIST1H2AE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HIST1H2AE antibody is: synthetic peptide directed towards the N-terminal region of Human HIST1H2AE. Synthetic peptide located within the following region: GKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAA

HIST1H2AE Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated